PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008929P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 324aa    MW: 35881 Da    PI: 8.1491
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008929P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32216270155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LHe+Fv++v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  MELO3C008929P1 216 KTRIRWTQDLHEKFVDCVNRLGGAEKATPKAILKLMDSEGLTIFHVKSHLQKYRI 270
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-16215270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28215271IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23216271IPR006447Myb domain, plants
PfamPF002491.9E-8220269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MNAYGIDSKQ EIQQNHGLIT DYYSQNFRAQ QPRRMGACVH LSAMDEVESS ERLNSCPSKP  60
TSTIINLFES PTSAFFATEQ CMGIPPIQFQ SGSSSFNSLS TIFQSSGENF SLDSAEQSGL  120
DSEFSNTLQS VVKSQLCKRS FNGLPKASFV EHKVFDGSSN TIKKHYSVPF KDQIGCYNSI  180
AQPSFCSNSP RFSCLSGSIG SGSSSSSFNG NGFTAKTRIR WTQDLHEKFV DCVNRLGGAE  240
KATPKAILKL MDSEGLTIFH VKSHLQKYRI AKYMPESAES RDFHTEKAFN FNFHTLFCAS  300
SLALNTYGTY GQRIISYNYN SNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818820.0LN681882.1 Cucumis melo genomic scaffold, anchoredscaffold00010.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442127.10.0PREDICTED: uncharacterized protein LOC103486080 isoform X1
TrEMBLA0A0A0L1621e-178A0A0A0L162_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s20540.14e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.21e-37G2-like family protein